DPCstruct | MC797
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2089 |
|---|---|
| Mean domain length (aa) | 75 ± 11 aa |
| Standard deviation of domain lengths | 11.24 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 22.62 |
| Pfam Score | 96.05 |
| Assigned Pfam label(s) | CL0113- PF16172- CL0010- PF16618- CL0465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L8F4C2 | 278-339 | GGQNAHNQVAIYPHQPQNADEIPLEPGDIIGVAGNHWDGYSKGINRKLGRTGLYPSYKVKEK |
| A0A167KG51 | 7-74 | FPLPASAEQPTFVRALYDYSATDAACLAFRKGDVIELLERMESGWWDGLLNGERGWFPSNYVEVLPNG |
| A0A7R9L1J9 | 383-442 | None |
| C3ZEF1 | 17-103 | None |
| A0A6S7GST5 | 136-208 | None |
| A0A6S7G977 | 869-930 | None |
| A0A6S7FWY9 | 745-804 | None |
| K7FGC2 | 238-301 | None |
| A0A5S6QP16 | 735-809 | None |
| A0A5S6QKM4 | 395-467 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.