DPCstruct | MC7968
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 91 ± 5 aa |
| Standard deviation of domain lengths | 5.20 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 56.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0458 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5QVL4 | 58-150 | GDLEALLPHVKKDSKLDSKNHLNLLPELADLHNCNNTLYFEARRHEDLYMWATKTPNGPSIKMHVQNVHTMDELKMTGNCLKGSRGL… |
| A0A1X7SST7 | 46-138 | NDIKTLLPHSRSDNKLDRKDDLSSLVELCEMKNCTKCIFFEMRKRKDLYMWISHLPNGPSAKFLVENVHTMNELKLTGNCLLGSRPL… |
| A0A1Y3NPC3 | 44-136 | None |
| A0A314Z343 | 149-227 | None |
| A0A367KPR1 | 287-379 | None |
| D5AA18 | 1-95 | None |
| A0A1S3IWX7 | 65-155 | None |
| T1P8B2 | 1-78 | None |
| D0N718 | 58-150 | None |
| Q1DGW4 | 1-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.