DPCstruct | MC7967
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 225 ± 14 aa |
| Standard deviation of domain lengths | 14.49 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 69.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5GXH7 | 1-227 | MNELEVLEEWKDQQDEEKYNRLATDAIQLDLTAKFSRNLVQRQEKNALKLFDNCKNRPDNCTSTDPLLELARSSIDQIKRLYLEEIS… |
| A0A7E4VA40 | 163-372 | HGEPSTSVPEKPEAKLEAEAVKNLEFFDPEEIKDEEGQRLSRLAANAVQMDLASKSYSFTAPRQMQAWISIFDKLKAITITDADELT… |
| A0A6V7YC31 | 62-311 | None |
| A0A0K0DJW7 | 71-281 | None |
| H3E106 | 831-1055 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.