DPCstruct | MC7966
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 715 ± 63 aa |
| Standard deviation of domain lengths | 62.77 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 15.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02206 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q9XWA6 | 160-938 | TANTTNSTKPAPTNPADFLNHITVVAHVSNGITLQAGLMNGSIPIVEVVDELLDLGSAKVADLVSFKEDKITALVSKLKEVRQGVAA… |
| A0A6A5GX53 | 47-826 | IENDYLFDLNSSREFLRPKRNAPPPDKLKELIDKSSTLARISNGIALQSGLMDGSIKIEDVVAELLNFGTLKVSDVVGFNVDLVKEL… |
| A0A1I7UGX7 | 164-951 | None |
| A0A2H2IIQ3 | 19-702 | None |
| A0A2H2I490 | 3-612 | None |
| K7H5E6 | 348-1086 | None |
| E3NW36 | 33-698 | None |
| A0A1I7UGX8 | 140-953 | None |
| A0A1I7U975 | 2-644 | None |
| A0A1I7UKN1 | 4-703 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.