DPCstruct | MC7965
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 87 ± 10 aa |
| Standard deviation of domain lengths | 9.78 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12096 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G5IG27 | 3-72 | PILALRALTEILSDETMRGRFLDLTGYDPATLRARAGEPDVANAVASFLNGHEPDLLAIARALDVKPEAL |
| A0A127EYK1 | 13-100 | ARREAAEALAISALTYLAAEPEALGGFLAATGIGPDQIRTAAGDPEFLSGVLDYFLSDEALLVAFAKHEDINPAELQRARVAFGGVWE |
| A0A501XJ12 | 30-116 | None |
| A0A1H8KNY6 | 1-87 | None |
| A0A7W7A7N2 | 2-70 | None |
| A0A4Q1TJP6 | 1-107 | None |
| A0A383F1H9 | 80-166 | None |
| A0A1I6ZW08 | 50-136 | None |
| A0A7G9SAR2 | 4-88 | None |
| A0A364P1N0 | 56-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.