DPCstruct | MC7964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 112 ± 6 aa |
| Standard deviation of domain lengths | 5.60 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 79.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 28.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A222FGH7 | 2-110 | SLVMASSAWASKLYRFKVEGRTVIKDHVPSEYKHLGYEVLNSRGMVIDRVDRALTPAEIKAREEAERRKEARIQAIADRRAKDMELL… |
| A0A119CWQ0 | 5-112 | VLAVALLLSAGAAHAQMYRWVDGNGRVHYSDTPPVTYQKSGGAELSKQGNVIRRTQSEAERRAEAERQAEQKRIQAEQNKQAQLDRA… |
| A0A849UGY9 | 10-116 | None |
| A0A661E6T3 | 16-135 | None |
| A0A3C0TC69 | 8-116 | None |
| A0A2E5C8E0 | 45-161 | None |
| A0A4R6ZYS6 | 6-114 | None |
| H8Z7N9 | 30-142 | None |
| A0A0Q9YK76 | 10-110 | None |
| A0A7C5CLU0 | 95-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.