DPCstruct | MC7963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 95 ± 5 aa |
| Standard deviation of domain lengths | 4.58 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D9DBZ5 | 34-124 | IFFHGMADNVVPYATAPHHFCKKNEPGYLILDGSRSIADRLKELDTPYMIYSFTGARHEISSIPFPYLKEVFQYFDDVFLNKVHQQI… |
| A0A561GCL0 | 1-102 | MLFHGTADKLVPYNKVRLLNRGFFGSKYLAHTFNKNGYPYYFQHVQDMGHEIAGSPMVENLPDILWFIENYIIKQKDYFMEVDFKDA… |
| A0A4Q6A5I7 | 117-205 | None |
| A0A3C2AAJ3 | 54-147 | None |
| A0A7V6G8B9 | 54-155 | None |
| A0A1V5HHM4 | 84-181 | None |
| A0A2S7L2Z2 | 48-138 | None |
| A0A2S7L2C6 | 1-91 | None |
| A0A645A5Z8 | 35-132 | None |
| A0A4Q6CYX9 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.