DPCstruct | MC7962
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 137 ± 10 aa |
| Standard deviation of domain lengths | 10.42 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09357 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A561G8T4 | 2-140 | LCTEQGFSSEEEEVHFFKNIKPDFYGQQVFVIERYTLERNMPYRDAEAQRLYFLAEVAYVERFFLSHPFAYEYHRAGATELNRQYFL… |
| A0A448B0E0 | 47-160 | KEYVLKRGFKNTDEEIHFFKHQKPVIVSKLIYYNAIYKIESKKPYGAKQIKKFLNKELKKLKKFFDNNIDFYKYYRSGNSFLDENFF… |
| A0A1U7Q047 | 1-129 | None |
| A0A2X2JED7 | 52-206 | None |
| A0A1H4AA30 | 94-228 | None |
| A0A0C1IK43 | 40-173 | None |
| A0A7Y3WB42 | 14-148 | None |
| A0A5J4QKA6 | 4-141 | None |
| A0A2E3SB86 | 46-187 | None |
| A0A6I3LTY7 | 53-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.