DPCstruct | MC796
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 61 ± 7 aa |
| Standard deviation of domain lengths | 6.82 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 55.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3CJ36 | 197-248 | WMVCGKPGCESTSSLKACGRCQTVRYCCPEHQKAHWAFPREPHKMFCFKAEY |
| A0A167K8B7 | 1-61 | MDGVQGLERCGRRDCAKTIENAQLFQCSRCEVVLYCSKRHQKEDWQDSRRPHKAWCYKTLW |
| A0A165K190 | 313-364 | None |
| A0A165C4T5 | 1-70 | None |
| A0A165CC76 | 52-121 | None |
| A0A167K8N4 | 151-210 | None |
| A0A167K8R8 | 268-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.