DPCstruct | MC7957
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 152 ± 18 aa |
| Standard deviation of domain lengths | 17.84 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 15.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6ZHT9 | 15-177 | FACGSSKSTATPAEIENLKKMVEQRAFEIESDYAYPVTTTALMSLQNAGLFLDGSNASSVSLIGNPNYLRVKGDSVFAELPYFGEVQ… |
| A0A3Q9INH0 | 13-182 | LLFTCLFAMGEKKQKSDTAGITKIEQLMKSREFYIEVDQAFPTGNSSITIDSKYGQKRIGGEGYISLATNEGQLFILDSVATGHLPF… |
| A0A2N2Z2X6 | 24-187 | None |
| A0A7W6HW89 | 11-171 | None |
| A0A352MF32 | 73-223 | None |
| A0A6S6MB82 | 2-125 | None |
| A0A556MHX7 | 15-177 | None |
| A0A840CRI5 | 41-190 | None |
| A0A379MNI1 | 11-166 | None |
| A0A060R860 | 24-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.