DPCstruct | MC7955
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 133 ± 29 aa |
| Standard deviation of domain lengths | 29.26 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 81.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 29.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P1WUW6 | 139-285 | CGWRAERWQGPGCLEVRRRCAACGQWLTARRTLAGPPRQRHLPVRCEGCRWDGQAEAEFVPVDPFRHDPPLDYLFGLPLWLATHTRH… |
| A0A1H3DHV6 | 18-137 | GLDVVCPQCKAKAAVVGWARLTCPSCSYVKAGRGNTLWGGPVDPHFHQPLWWQADFRGHTLWAFNRRHLTLLENYVAADLRERGPIA… |
| A0A7W5VI40 | 1-85 | None |
| A0A3M9MLL9 | 87-234 | None |
| A0A255PUA7 | 1-78 | None |
| A0A3D9QWZ3 | 111-275 | None |
| A0A1T4PSV6 | 18-170 | None |
| A0A1I4U6M7 | 5-129 | None |
| A0A7Y0FR11 | 15-119 | None |
| A0A1Z2KVM5 | 14-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.