DPCstruct | MC7954
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 223 ± 49 aa |
| Standard deviation of domain lengths | 49.46 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 84.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 12.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14011 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H2Y5G3 | 5-243 | KPEQFRVEELAAIVTKTTGGDLHIVLAPQAVWLPPDVKAQADRAVEEALMRYPDDPDERDEPDFKAICELLSRPPEARYGWISDTVN… |
| A0A4Q7NNV0 | 14-205 | VDPDGLARLREAHAAGAAEGPAASALAVQGVPEALDALSAPLVVAELVVAGPDLVTSSTAFLDRDVCALLLAVHDEVAQLLVTAPAA… |
| A0A285LAP7 | 217-371 | None |
| A0A4Q7J6E2 | 9-246 | None |
| A0A1G5GCK4 | 7-240 | None |
| A0A2N3S159 | 17-273 | None |
| A0A1H0CQM0 | 157-381 | None |
| W5W4S9 | 16-253 | None |
| A0A5R8PCN8 | 7-217 | None |
| A0A7W5F720 | 2-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.