DPCstruct | MC7953
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 100 ± 10 aa |
| Standard deviation of domain lengths | 9.77 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 26.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20619 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A442J2Q9 | 10-107 | AGTVRLVCICVAIASLLAVAPWPYGYYQFLRVVVFFAGIYCGAMVWRSGPENRTLAWALFGAAAIFNPFMPVHLPRELWAIFNVAAA… |
| A0A1G1F2G5 | 31-129 | KKKIQTTTIVKTIAILMLFWALTDNPYGYYQILRWVIAGVTGYSAYLAYEQGRNTWTWIMAITSILFNPIVPIYLDRETWTVLNIIA… |
| A0A2G1C046 | 6-102 | None |
| A0A7K3ZBR2 | 1-99 | None |
| A0A1H3RMY3 | 3-98 | None |
| A0A519N3K7 | 4-98 | None |
| A0A2H0C6B6 | 10-104 | None |
| A0A4R9B3A8 | 137-238 | None |
| A0A378RK83 | 33-136 | None |
| A0A7L7W4T1 | 185-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.