DPCstruct | MC7952
Metacluster Properties and Pfam Annotations
| Number of structural domains | 117 |
|---|---|
| Mean domain length (aa) | 76 ± 9 aa |
| Standard deviation of domain lengths | 9.09 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0183 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8FK62 | 50-130 | RENRALKKYKSQQKKLEQELSDTLTKVLAGYLPICARCKRIREENGVWKQLETYIQAHSEVVFSHSLCPACAKSFYPEFLP |
| A0A1G1EZT6 | 320-401 | ELRRHREELELLIEERTKNLRKTLAEVKTLRGILPICSYCKKIRDDKGYWEQMELYIRDHSEAEFSHGMCPDCAKKAYEELE |
| A0A2N1R7N9 | 23-81 | None |
| A0A532EDR4 | 92-150 | None |
| A0A1Q7B750 | 85-149 | None |
| A0A3N9MUA0 | 74-172 | None |
| A0A2N6FA37 | 176-242 | None |
| A0A1G1FV11 | 381-457 | None |
| A0A0A8WSW5 | 125-207 | None |
| A0A3A4ZEU7 | 3-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.