DPCstruct | MC7950
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 207 ± 29 aa |
| Standard deviation of domain lengths | 29.17 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4C082 | 159-385 | GEKIGFQQGKIDFENKVVQQNPQTNSSQTEYWNKGFAAGYKKVIQVMQQTEKAKEEGHQQGLTHEDINIPSKYASEDETKQAFEEGF… |
| N1LJW9 | 25-228 | VHVAGKSDAYKQAFKATYAAVWSLEEQKKTHFEKGKEQGLAQETMDDSQVAPEFKVNFADGFKVGNKERTEKIEKEQAELGEKTGKE… |
| A0A1E8BD48 | 1-159 | None |
| A0A848MDA9 | 41-234 | None |
| A0A094WL10 | 3-179 | None |
| A0A1B8RMP9 | 90-271 | None |
| A0A7X0SFY2 | 64-283 | None |
| A0A2N5MHT7 | 53-272 | None |
| A0A078MGF9 | 2-187 | None |
| A0A3C1I2X0 | 34-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.