DPCstruct | MC795
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 190 ± 20 aa |
| Standard deviation of domain lengths | 19.79 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H4NHS5 | 415-617 | GPGWWRHLLPPAKEVMVFDKTVSLSFPFAIKAGDPIGHMGYYQAPKDGGYEARYQVHIECTSMDDNLENFLTNPEKVGEKNPLWLKY… |
| A0A379SF55 | 34-193 | LLFDSVHTVEDTEEWKVSAGTPVGFMGCEEYPGRESGQVECEWFVHLEVLSADPGMPAFLGNPEGVKGEKRTVLAPKGKLLYTRQTT… |
| A0A3S5DEA7 | 410-578 | None |
| A0A2X4TSL5 | 1-178 | None |
| A0A855LRH0 | 84-260 | None |
| A0A7Z0Y1Z4 | 21-242 | None |
| A0A3N6UZI5 | 1-166 | None |
| C9Y3H2 | 1-210 | None |
| A0A4T8SLY6 | 234-430 | None |
| A0A2N0DRC3 | 232-405 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.