DPCstruct | MC7949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 109 ± 11 aa |
| Standard deviation of domain lengths | 10.78 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A809N6J6 | 3-102 | IISTFISLGTFGIVAYRFGRDNHKISIIIHRDNLEQEIPIKILRKQVTRSEILGILGTLDRESNFSIAYTGEKAFFDNMVAVQSGWR… |
| A0A698FRU6 | 16-115 | IVFSFITMLIVVLSFKQKLKENNEITIILQTNSQSKTLPVKILRRNFTRAELLGYLGIYNNSTQNFNIAYLTEPQFMQDVLNIQKGK… |
| A0A7D8YI13 | 8-133 | None |
| A0A1C3H5N1 | 40-147 | None |
| A0A6S6S5D6 | 63-168 | None |
| A0A7Y5F120 | 9-131 | None |
| A0A4P9DU51 | 59-175 | None |
| A0A4P9DTR5 | 8-102 | None |
| A0A1R4B2T7 | 58-159 | None |
| A0A2M8NPR9 | 5-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.