DPCstruct | MC7944
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 129 ± 14 aa |
| Standard deviation of domain lengths | 13.85 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y8YA67 | 4-123 | TAAEVITEQDVRTYKYGGCGSLALAIHEATGWPIVAAVADDGLELHYAATRPDGRLVDITGAHTEDDMLLEYEFHADGGAVTLVDVT… |
| A0A2T0GSN7 | 50-176 | AYCHYLAGTLASYTGWPVVTIDYQTEDGDWRPAHSGVRTPQGSVLDIFGVNSLSAVLDRYARANNSPVRYRVMRGEDLPTNVMTGAD… |
| A0A367UH66 | 6-158 | None |
| A0A0Q4NGL0 | 22-164 | None |
| A0A2U2C754 | 3-150 | None |
| A0A368UA55 | 65-188 | None |
| A0A3D9X002 | 29-165 | None |
| A0A3D9X2A4 | 40-154 | None |
| A0A1J0SXD2 | 42-161 | None |
| A0A2N2AMK1 | 46-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.