DPCstruct | MC7942
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 60 ± 3 aa |
| Standard deviation of domain lengths | 3.11 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 53.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y8Y3G0 | 1-64 | MGPGHWTVLYETTDGARWRTEARRLMAEHEVRDPSMFRLDTLCGRTVLPTTYRLSVFAPDAPGR |
| A0A1H9Q5Y0 | 38-99 | TGRWVVHFETQDHAEYREYVRRLRAVPEQAGLTRADLEVARLDALCGREVHPTTYRLSVFVP |
| F2RA91 | 30-87 | None |
| A0A124C3W1 | 12-67 | None |
| A0A1M6R2P0 | 25-85 | None |
| A0A7W7M0H9 | 2-61 | None |
| A0A852ZVF3 | 1-62 | None |
| A0A5P2A9W9 | 25-84 | None |
| A0A2X2LUY0 | 51-105 | None |
| A0A3R9VSS0 | 25-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.