DPCstruct | MC7941
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 255 ± 27 aa |
| Standard deviation of domain lengths | 27.32 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C4QMP0 | 3-236 | ELSGLPVCEVVLAADGRAWVDGIPVRPAADLDAARTAARDHVRRLAVRARRPHVVRAREPDGARYSCVISAEGEVLPESEAGRLPDD… |
| A0A4Y8Y295 | 1-293 | MSTMRESADVPAWPVYALTVHDDGRVLASGPLIETSGHPTRAAAIEVVAGAAGRLGRSVRATASEPDGAVWPLIVSPDGEVSEVKTG… |
| A0A652KKV8 | 1-264 | None |
| A0A7X0K938 | 1-282 | None |
| A0A101RNK6 | 1-242 | None |
| A0A1M7PGD0 | 47-253 | None |
| A0A7X6KY46 | 10-286 | None |
| A0A7Y5XNB8 | 1-249 | None |
| A0A7Y9HIH0 | 16-225 | None |
| A0A3N1DTN5 | 2-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.