DPCstruct | MC794
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 130 ± 12 aa |
| Standard deviation of domain lengths | 11.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 62.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A827AZT2 | 1-85 | SRQRRDLWKAESQYAVLKEAATKRQLSWQEKSLLAHEKETLEYKRQLADLGDKVEHQKRLNELAQQAARFEQQQGAKQAAISAQA |
| A0A379R1F8 | 2-133 | DSAQADLMALRAQLKVLQQHAGMNDTISQQRKELWATEAKFQVLEESAFHRKLSAQEKSLLSSKAQVLQLARQKALIGDQIAHQEHL… |
| A0A7U9G2T3 | 151-283 | None |
| A0A826VZ93 | 2-128 | None |
| A0A376RUW9 | 9-122 | None |
| A0A8B4PFA8 | 30-162 | None |
| A0A377YWH0 | 3-121 | None |
| A0A377KCT1 | 215-347 | None |
| A0A3P4KZ30 | 204-336 | None |
| A0A484X5S6 | 6-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.