DPCstruct | MC7939
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 114 ± 16 aa |
| Standard deviation of domain lengths | 15.93 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 23.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2B7ZP76 | 2-113 | KKIFRTAKGMISAASKKFTSVTAIRGGTAYPKKPSELLNLGIRWDFDGEVTINGVVYNKFQVQPNAGKVPPSVSEWRRKNGGTHAVM… |
| A0A409WW17 | 106-230 | NSRFTREMENLLNTVVDSLVSGTGWTKFVNPTVRRGATAWPRKPADQQYLGVRYDYHGEVTIDGVEYYVFQMQPNRGHDVPSSIKKW… |
| T5C2F2 | 72-168 | None |
| A0A1Z5TCA5 | 76-194 | None |
| A0A6A6YZ01 | 48-176 | None |
| F2SIN4 | 1-101 | None |
| A0A2J6TL14 | 205-303 | None |
| M5FUW4 | 88-207 | None |
| M1VX59 | 4-132 | None |
| A0A0C3GVS3 | 155-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.