DPCstruct | MC7937
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 145 ± 3 aa |
| Standard deviation of domain lengths | 2.96 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 65.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6RVA5 | 797-943 | RTALPPRSHIPSSLSSKFSAPPPIPPQSQTASPVPRKYIAPPFSPQTTLPVTQKVNAPPLPPQHQTDPVLHIKWNAADETQLIGHKC… |
| A0A835M2T2 | 741-884 | LGPSLSGKPVPVAGGVELIRTSEGLPGQTSQRSIIPNASTTLRAARGRRTPQPLVNRSTPTVSKTSPVYHLKWKDPTDLYQSSGENC… |
| A0A6P3Z0Y5 | 606-750 | None |
| A0A1R3HUD2 | 545-695 | None |
| A0A200QHA7 | 472-612 | None |
| A0A6S7M2B3 | 596-741 | None |
| A0A5D3CG54 | 362-504 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.