DPCstruct | MC7935
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 185 ± 23 aa |
| Standard deviation of domain lengths | 23.34 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12102 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V1BIR9 | 46-228 | LAAALSLTARRYAFERQRPVTGSAFASFFRRDVAALARALTDRRPERLLVRASTGAPGWASIPWLACFAPHVTRSMRHGLYVVIFID… |
| A0A2E9E7J2 | 3-211 | RNTILDIARAWPTYRSLRATDKTYPAHKLITESFPSLLRDSLPPDPKLKFEGSPGRGYITAAPWIATFDKRVSTKASEGFYPVYLFS… |
| A0A4V1V1N3 | 7-171 | None |
| A0A7M1TZQ0 | 2-190 | None |
| A0A109QJD3 | 1-162 | None |
| A0A1E4ETJ1 | 5-161 | None |
| A0A7U3FCU6 | 7-211 | None |
| A0A4V6NZZ0 | 4-170 | None |
| A0A1I5VI99 | 162-369 | None |
| H0ABM2 | 121-323 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.