DPCstruct | MC7933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 749 ± 76 aa |
| Standard deviation of domain lengths | 76.38 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844Z2E6 | 4-581 | DVLTAIVTGGGGKERLVEAADAILDAAEVGPGVFNALTEQANRPRWRDKIAELYINMLLSGPQTHAVNIVSNTLTAMAQLPEFAGAA… |
| A0A2E8UCL8 | 2-745 | DEYALNKYISGWRLRNKNWFDQIPPKELDTVIEQLTEEFVSAENAIHAKNVRFTNTLKNLKKTKPSAMRPLVDAFAHTNGDVDTLAK… |
| A0A5C7PS17 | 53-774 | None |
| A0A838P6T2 | 195-999 | None |
| A0A2E6PX03 | 162-947 | None |
| A0A2M7RHA6 | 120-776 | None |
| A0A2D5F8A7 | 268-1121 | None |
| A0A6A7LY93 | 352-1156 | None |
| A0A3N5LC65 | 433-1198 | None |
| A0A2D5PMN9 | 251-970 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.