DPCstruct | MC7930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 123 ± 8 aa |
| Standard deviation of domain lengths | 8.31 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 31.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9IAN2 | 52-175 | VSDEWDNFFISNRDEIRRLENMYGNLKLQEIVTKFYERDKSKILEYKNRLVQNYDPVYLDPEKRGYFAFRTHFFAPSKYFMGRLFDT… |
| A0A7C7VUM3 | 8-115 | QKEFLRIKKQYTNDKLSDFVRNKNTLEGIVEYNNRLYRKIDPIYQDPKNKFIKAQFYAPRKQLFGFWVDTFWMNFFVIWIVIIGLFI… |
| A0A7X7HPY4 | 13-140 | None |
| A0A7X6PFU2 | 83-206 | None |
| A0A354BT03 | 5-139 | None |
| A0A1F3NFA0 | 179-302 | None |
| A0A661ZYE2 | 227-351 | None |
| A0A2A5FMX1 | 849-959 | None |
| A0A2A4Q4I8 | 135-268 | None |
| A0A7C1M7D4 | 537-654 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.