DPCstruct | MC793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 110 ± 9 aa |
| Standard deviation of domain lengths | 8.58 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W8I2F3 | 2-101 | ATPPKGVQEAAQRALRWIEDGKAGKNFTDTGRTRAKQLADGDDVSEEVLTKMRAYFRRHEADKDADGFTSGGDGFPSPGRVAWDAWG… |
| B0RZ02 | 4-118 | TSTTKILNTTPPKTVANAAARGLRLREQHGRGGTAIGVARARDLSIQKQLSAQTIRRMHAYFARHSVDKTGKGWADRTKPSAGYIAW… |
| A0A2D8XEK8 | 4-105 | None |
| A0A6C0H7B1 | 149-271 | None |
| A0A6M3KCW5 | 2-111 | None |
| A0A4U7DQK1 | 432-533 | None |
| A0A4S4CIM5 | 1-110 | None |
| A0A2E9V8L7 | 73-183 | None |
| A0A4P6V0P4 | 8-111 | None |
| A0A7J3BBS0 | 173-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.