DPCstruct | MC7929
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 88 ± 10 aa |
| Standard deviation of domain lengths | 10.30 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00206 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7VP83 | 2-81 | KFRREKDSLGEVQVPAEALYGAQTQRAVDNFPISGLRFPRPFLWALGQIKAAAAEVNRDLGRLDPKRAAAIVQAAEEVAQ |
| A0A496JVH0 | 2-93 | TVRIEHDLLGDREIPAEVYWGIHTLRAIENFKISTQKISDVPQFVRSMVMVKKATAQANGALGAIKPEIAAAIEKACDEVLVKGRCL… |
| R9AA50 | 518-605 | None |
| A0A2P5BJE1 | 441-529 | None |
| A0A817LHZ9 | 10-92 | None |
| B6A0Z2 | 1-80 | None |
| A0A1A9X731 | 81-169 | None |
| A0A0D3BNG7 | 683-764 | None |
| A0A661P647 | 157-251 | None |
| A0A7V5J4D3 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.