DPCstruct | MC7928
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 135 ± 19 aa |
| Standard deviation of domain lengths | 18.55 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G0YR88 | 4-150 | GKVAYISYALFVIILAAFIAKGFLPKGVSEELEEGVVSEVEDLLPSGEEGSPKQIRGSCDLIEMGSTCVEYYGSYWNNQTIELACSE… |
| A0A7C7VB98 | 1-176 | MKGKTIGWAVTVALTTAILTFWHLAQENTAEVELSPVVVTQEPIEIILTPVVMTAEPTPETLPSVVMTIALTEEVIDIYIKPQGACV… |
| A0A1F9NS96 | 4-154 | None |
| A0A521TZ38 | 1-132 | None |
| A0A2N6AAG0 | 99-221 | None |
| A0A150WRI7 | 1-134 | None |
| A0A848Y1C6 | 32-167 | None |
| A0A259TZW1 | 67-197 | None |
| A0A5F2A5G7 | 1-124 | None |
| A6G6W9 | 6-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.