DPCstruct | MC7926
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 425 ± 45 aa |
| Standard deviation of domain lengths | 44.57 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.26 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 16.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13559 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1SX54 | 6-503 | QTALDFLFVVTEVIPWFAAVRLAATATERSFLRDVADRLQGEVATVDARQTLLDVREASESVVSGPSLLLVLVAALGAFALMRWMQR… |
| A0A524PQL6 | 18-482 | PWWEILSVLMLMLMDLSWITPTYSFLVGWSLGGSKVTAFLVFGVIYLASYMVASIHKLEDKFIGMLQVVLLAVLLLGLIWAAGALIY… |
| A0A2E2YM45 | 4-453 | None |
| F2NQ63 | 4-477 | None |
| A0A7Z9WN14 | 2-432 | None |
| A0A0P6YZ61 | 1-433 | None |
| A0A329KEP4 | 70-489 | None |
| A0A369B9H6 | 8-457 | None |
| I7J4J7 | 3-353 | None |
| A0A1F8T744 | 3-357 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.