DPCstruct | MC7925
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 154 ± 25 aa |
| Standard deviation of domain lengths | 25.15 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.95 |
| Pfam Score | 85.15 |
| Assigned Pfam label(s) | PF01849- CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815IBZ2 | 328-484 | EATGIREEMQSKQKQTRSEKKARKAMAKLGLRPVTGILRVTIRKSKNILFVIQKPDVYKSPASDTYIVFGEAKIEDLTQRAQIAAAN… |
| A0A0E0CCS8 | 19-126 | KIESRSEKKSRKAMQKLGMKTITGVSRVTIKKSKNILFVISKPDVFKSPNSDTYVIFAAQDDEEVDESGVEPKDIELVMTQATVSRS… |
| A0A177BAH4 | 7-176 | None |
| A0A3Q3G252 | 329-499 | None |
| A0A835HLQ6 | 10-114 | None |
| E7EZQ7 | 1693-1870 | None |
| A0A4Y7KRF9 | 3-145 | None |
| A0A3P7D7A2 | 1-151 | None |
| A0A2I4CBF6 | 566-750 | None |
| A0A6S7NDV2 | 289-438 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.