DPCstruct | MC7923
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 69 ± 4 aa |
| Standard deviation of domain lengths | 3.90 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 54.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00276 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A286ZZC6 | 3-67 | RNVLYPLYQLGNPQLRVFRTNFFIQLVRPGTAQPEDTVQFRIPMEMTRVDLRNYLERIYNVPVAA |
| A0A815EIT3 | 15-87 | TPRYPKWQPGNPRHRLFFPQFWMRVMRPLENRPIRPNCVRFECHIEMTKDDIRNYLEKIYKIPVLDVTTYIDQ |
| A0A2R7W019 | 30-100 | None |
| A0A132A408 | 318-391 | None |
| M7BXN3 | 204-266 | None |
| A0A2G8LB79 | 21-87 | None |
| A0A4Z2C8U6 | 2-77 | None |
| A0A0K8RGS3 | 1-68 | None |
| A0A3B3R4W7 | 1-67 | None |
| A0A6J8C5R3 | 17-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.