DPCstruct | MC7921
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 97 ± 12 aa |
| Standard deviation of domain lengths | 12.42 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11630 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815DW44 | 3-92 | CILDIGTQIWKIHQWGSDQAITICGINCVGNIKGRFSGFEWKWDGKFQCQEKAPGIVGQTTKYSRDGAMEHAIQDFLVKAVTAGKLK… |
| A0A3R7Q9V9 | 194-293 | GLVLTENVNTKEKLLTYIAQELTWHGRNGSVTFLHNKCEFSVTPKSKDWMPYHESNFSCPDWTNIVGEATGRCRVLTAAKAAKDFVV… |
| A0A1W0X6B6 | 45-131 | None |
| A0A819RHE6 | 5-106 | None |
| C4M4W5 | 24-99 | None |
| A0A820BAL6 | 119-218 | None |
| A0A7R8XIQ7 | 1-88 | None |
| A0A816EG86 | 22-127 | None |
| A0A818BYV7 | 6-96 | None |
| A0A1S5RQS8 | 133-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.