DPCstruct | MC792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 79 ± 4 aa |
| Standard deviation of domain lengths | 3.90 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 95.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 41.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P1ZSB4 | 2-73 | LEKLANLQHEIWSHWMTYLFEVSTLNEDGSVTIPADKVERWKRQMKTHYSELPINEKKSDLAQAQKVIDVID |
| B0RUS9 | 7-93 | EEAERLLNTIVEELASIEHARWAHWQSYLHGQGIRQEDGSIVLPAPLVERWERQIATAYEDLTHEEKSADREQVMKYLPTIKKAILN |
| A0A0F9KMJ1 | 2-77 | None |
| A0A0F9WGL8 | 3-85 | None |
| A0A2S7BUY3 | 4-79 | None |
| A0A0J6SN45 | 6-89 | None |
| A0A7C1L040 | 40-119 | None |
| A0A7C1KYJ7 | 96-169 | None |
| A0A7C1VNY4 | 57-132 | None |
| A0A6H1ZAC1 | 4-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.