DPCstruct | MC7919
Metacluster Properties and Pfam Annotations
| Number of structural domains | 117 |
|---|---|
| Mean domain length (aa) | 202 ± 42 aa |
| Standard deviation of domain lengths | 42.18 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 82.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.45 |
| Pfam Score | 85.57 |
| Assigned Pfam label(s) | CL0023- PF01043 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453HJH7 | 16-217 | ARFVTNALKAKEFYRRDVQYIVRNGKALIINELTGRVEPKRRWSDGIHQAVEAKEGLKIQADSVIVAQITYQSLFKLYPKLSGMTGT… |
| A0A815DNS5 | 3-180 | IWIQSAFHVRDMTPNDTYIVSRDKLSPKSDVQITVMDKDTGIEQASTRWSNGVHQFLQLKHMRRITPESLKAVFISNMSFFKRCRNH… |
| A0A7J0EG05 | 6-195 | None |
| A0A6A8IE70 | 235-442 | None |
| A0A505IM71 | 1-163 | None |
| A0A815L0E6 | 96-349 | None |
| A0A6P0UUY3 | 267-495 | None |
| A0A819Q9G8 | 4-288 | None |
| A0A2V7Y5A3 | 299-527 | None |
| D4YK20 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.