DPCstruct | MC7916
Metacluster Properties and Pfam Annotations
| Number of structural domains | 121 |
|---|---|
| Mean domain length (aa) | 219 ± 28 aa |
| Standard deviation of domain lengths | 27.93 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 15.49 |
| Pfam Score | 28.89 |
| Assigned Pfam label(s) | CL0010- CL0014- PF18650- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815BL21 | 7-216 | LDDAPLVIFENVQSIPKIGVPGVIIPRTADTRALLCVENPQQCLMIAARSGLGRVLVFAHNGYVSTFQSPIDSKFQPFVNNCIKWLV… |
| A0A485I6E6 | 44-270 | QLTDSHLVALRLQQQVERIRQTRTQLLDGLYQNLSQAYDPGAASMWVLPANPDNTLPFLIGDKGRVLASLSLEAGGRGLAYGTNVLT… |
| A0A7J5YFU7 | 73-278 | None |
| A0A3E1E1R0 | 1-249 | None |
| A0A0G0LIQ3 | 179-399 | None |
| G3HL41 | 9-210 | None |
| A0A5F4WH97 | 100-305 | None |
| A0A7J6S3N0 | 9-201 | None |
| A0A6B9Z9S3 | 17-246 | None |
| A0A419GTL3 | 395-604 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.