DPCstruct | MC7915
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 427 ± 97 aa |
| Standard deviation of domain lengths | 97.47 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 73.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07782 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3IFN8 | 328-788 | KSFTGALVGGLLGAVLYLACYYAIGYSLVISCIIAGLSTIFMSVGFAISVHCRCIALLMIPGLCTTRGRAATLSIIMTLLLNGPITN… |
| A0A814ZPF8 | 29-495 | TKSVVGFLIGLCGISLMRHMAIFVFRAKITAVAIWIIAAGLILPWGLAFSMVIRCLTLLILPTFISNRGQLIMYALISNHLVRYVIT… |
| T1KVI9 | 62-619 | None |
| A0A7M7LSQ9 | 577-1169 | None |
| A0A3B4VB25 | 4-312 | None |
| A0A0D8XN85 | 10-333 | None |
| A0A2I4CVA2 | 34-507 | None |
| A0A7M5U0P1 | 92-431 | None |
| A0A811LCD7 | 15-626 | None |
| A0A553MWQ6 | 68-416 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.