DPCstruct | MC7914
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 234 ± 39 aa |
| Standard deviation of domain lengths | 39.19 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 39.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814ZA03 | 51-311 | LSEATNSLSVTLVAVILAPQISDLLSVDESKAEQLLAKGRQALIDFQNDIAPTVYTEQMSEDKWFQTFLNEQKLAAPDLYDQILTRT… |
| A0A815VHC5 | 26-248 | HDYDNKQDIVTHLLINGRQGLLDYKDDIIPKIFNTQFNTPDAQLILALKTYVRRLWQTQYESSCHWLIAFIQNYHDNKDPQLYDRIL… |
| A0A817MQS7 | 13-249 | None |
| A0A814YBS5 | 15-297 | None |
| A0A820S4Z6 | 36-296 | None |
| A0A820A548 | 3-140 | None |
| A0A815V895 | 3-236 | None |
| A0A819WMK5 | 39-268 | None |
| A0A819PD45 | 64-309 | None |
| A0A822CYG7 | 1-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.