DPCstruct | MC7913
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 200 ± 22 aa |
| Standard deviation of domain lengths | 22.11 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 67.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 39.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6BTQ1 | 530-730 | EASVAPDTSHLWLEFSHPVESLALTVEEVMDVRRVLVKAEMEKFLQNKELFNSLKKGKICCCCRTKFPLFSWPPTCLFCKRAVCTSC… |
| A0A4W3JWL4 | 111-313 | TQDVPGNESTCSRRQWMDEFSHPVESLTLTVEEVSNVRKVLVKAEMEKFAQNKDLHNNLKKGKVCCCCKVKFPLISWPSSCLFCKRA… |
| A0A7R9LGE5 | 187-350 | None |
| U3IHF3 | 701-886 | None |
| M7BXK7 | 528-707 | None |
| A0A7J8DL01 | 60-276 | None |
| A0A5N4CJD0 | 1-217 | None |
| G1PSJ8 | 363-545 | None |
| A0A3R7QEZ1 | 2-247 | None |
| A0A2S2NS06 | 56-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.