DPCstruct | MC7912
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 115 ± 15 aa |
| Standard deviation of domain lengths | 14.95 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815AFC7 | 3-111 | IDDIGDLFELIKDKIGLKFSSVLLYMTLRYFGINWLKCDDFFKTVGASTTKTVDKWASIFLSGNYNEFVSEGRGGKQIPNFYDVFPD… |
| A0A814WQW7 | 40-141 | AMETEAEAVQENKEPLNFTNEVFVNDIGDLFELCKAICPVKHLSVLIYMILRHFGMKWRAISDFLSRIGAQTSVTAHKWTQIFVSGD… |
| A0A817S4F7 | 194-298 | None |
| A0A819Q5Z6 | 26-132 | None |
| A0A817KB42 | 98-235 | None |
| A0A817LFZ8 | 51-189 | None |
| A0A815PW65 | 2-107 | None |
| A0A815NIY5 | 2-111 | None |
| A0A819MKS5 | 4-122 | None |
| A0A819P7Y7 | 20-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.