DPCstruct | MC7911
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 148 ± 26 aa |
| Standard deviation of domain lengths | 25.94 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0013 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R3L4L2 | 7-146 | KVTHYLHDSLGEEGAKWGLSLIDQKTGKSLAWQDNEWFIPASNQKLWTSAVALDQLGPDYRWTTQFGVSDQTLWVIGGGDPVYSWDD… |
| A0A814VU82 | 5-136 | TTFHDAWNNFIQDNQVSHASYSITVLNSSSGSIIFEQNKDVGLSPASTLKTITTAAALHYLGKDFVYTTLLQYSGSIDSYGNLDGYI… |
| A0A7D7VF19 | 25-168 | None |
| A0A352AR71 | 17-162 | None |
| A0A2V7WCC3 | 73-186 | None |
| A0A6N3UBT2 | 20-150 | None |
| A0A7Z6T9I4 | 20-130 | None |
| A0A0K2QWB1 | 4-166 | None |
| A0A6I5WNI9 | 12-143 | None |
| A0A3C1R523 | 15-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.