DPCstruct | MC7910
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 176 ± 13 aa |
| Standard deviation of domain lengths | 12.71 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 57.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815VH52 | 533-715 | CHQIQFTLSSNSHALSVFPKLHKYYSEFSQQIDTCVKENTQNRWDTLSIWIQEKLSSNPKELEPNEIKAMLILNIYYDYYCNNQLES… |
| A0A814VHD5 | 6-169 | IYIIYQRYQIFTVCVNDTTQQRWKALTDWFQLQLNSNPPLSALNEIKTVLFLKIYYNYYCNNQLSLLNMLLETIENTLQLSTEELQV… |
| A0A820ZG55 | 236-414 | None |
| A0A815RK53 | 68-257 | None |
| A0A820V6P3 | 132-314 | None |
| A0A820A071 | 377-560 | None |
| A0A814VXS6 | 14-190 | None |
| A0A817SQ29 | 422-609 | None |
| A0A816HCW1 | 1-167 | None |
| A0A821BT85 | 252-437 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.