DPCstruct | MC791
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 64 ± 5 aa |
| Standard deviation of domain lengths | 5.35 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.27 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | PF11918- CL0127 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D0MVK2 | 71-134 | EMKFINFGIEKIERLKGNIGYIDIRMFPDINIAKDKYIAAMKMLEDSEALIIDLRKHSGGDPAT |
| A0A2E4UWD7 | 20-83 | WRASQNQGFEAASQRDGNVGYLDLWDFYPRKETAAVAAGTMAMQAVTSPKIIDPCNKRSGLPET |
| W4V755 | 63-116 | None |
| A0A7W1EW94 | 123-187 | None |
| A0A4V6MYU5 | 145-210 | None |
| A0A5B7R204 | 16-88 | None |
| A0A3C1NMV9 | 1-61 | None |
| A0A2A4YSQ8 | 493-549 | None |
| A0A516KKP7 | 106-169 | None |
| A0A2V8ZS44 | 308-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.