DPCstruct | MC7906
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 167 ± 21 aa |
| Standard deviation of domain lengths | 20.78 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 28.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0QTM7 | 3-171 | SFASTVLGLPPIAALVFSYQHGVYACVRHRFVEFATAVGFDAATDGRYHLCRHVQSRLDHPLRSVSTLSVRELFLFSENDRDIRFVL… |
| A0A485LBP6 | 29-224 | AALPPTGRWQSPWHAVLFDETLLKEILPYQNGIFGDLLPRYQEWQQVRDTAAPSSDLRFLTYELPSRYRSVPAVGESLRVYAGYSLF… |
| A0A067CDH7 | 7-144 | None |
| A0A067BX52 | 1-175 | None |
| A0A1W0A3U8 | 5-167 | None |
| A0A067CG45 | 3-151 | None |
| W4FQJ3 | 1-209 | None |
| A0A6G0WIT4 | 2-140 | None |
| A0A485L3V5 | 83-241 | None |
| T0RW86 | 2-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.