DPCstruct | MC7904
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 134 ± 23 aa |
| Standard deviation of domain lengths | 23.05 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14388 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485L501 | 3-124 | VEMTQKMEEYLVDPTLSQWLLPGFSTTTDHDRIVGSVVMMASMKKYFTYKFCLECGIPSITLLGTVADWLAIRARVDKLQEYGLGEW… |
| A0A1L9QMT2 | 31-151 | AVHEWTLLIRDRVGAEVYHLLECNFSTTTPNALTASRIVMMDAFRQYFDYKMIGACGIPKITLLGTVQDWQSICDRVRMMAEYNLNW… |
| A0A2A9NAM9 | 1-119 | None |
| A0A1L7VSN7 | 127-290 | None |
| A0A2Z6RSS1 | 22-145 | None |
| A0A146I7X1 | 828-956 | None |
| A0A5J4VGM9 | 227-347 | None |
| A0A821JGE4 | 1-112 | None |
| A0A397SBA1 | 11-129 | None |
| C4JSW3 | 160-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.