DPCstruct | MC7903
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 111 ± 19 aa |
| Standard deviation of domain lengths | 19.29 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0XKZ8 | 344-421 | KQCTQVSVLGDATYCIPYGVPICSGSGILPAGTACPAEGDKAVADCHSYLPSFASNNCVAPTNAACQKIGSGAWGCVW |
| A0A485L4X1 | 1-117 | MQLLAATFLVAATALAQSSDPPSCTPVSVEHDATYCIDGAICSGDGTVPPAGTACPVQGDIASASCDNVYLPSYSIEYGNCVAPTDA… |
| K3X4H5 | 16-149 | None |
| A0A1V9Z2D2 | 39-178 | None |
| A0A0A7CP44 | 99-212 | None |
| A0A0A7CMK9 | 25-111 | None |
| K3WJF7 | 4-103 | None |
| K3WF37 | 7-103 | None |
| A0A067BIT0 | 67-182 | None |
| A0A6G0XXY2 | 1-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.