DPCstruct | MC790
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 96 ± 11 aa |
| Standard deviation of domain lengths | 11.09 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 21.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y4AXR3 | 35-128 | FRVNLFDEINPEIFVQYLQNAGWKLFPRKRQDIKVFQIEKKDQLYQVTIPLDRTLGDYRNAMQMAVKEVALYEDITEWEVLLCLFFW… |
| G7ZFH3 | 10-108 | IFSARTTQVVRYLPHERVAAYLKAHGWQDAGPYGPHARIYSLGKGATKKELVLPTTNDVADYQWRMQDIVQTLARLERRAVAAVCTD… |
| A0A327KBZ0 | 2-103 | None |
| A0A3S1CKM9 | 12-109 | None |
| A0A6N9EP44 | 10-86 | None |
| A0A6L9ZQD0 | 5-93 | None |
| A0A173TRU8 | 66-158 | None |
| A0A0P9F0U7 | 16-116 | None |
| A0A2T2WI25 | 7-101 | None |
| A0A426TYZ9 | 8-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.