DPCstruct | MC79
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 102 ± 8 aa |
| Standard deviation of domain lengths | 8.09 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00547 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K8L3Q7 | 20-118 | GEATDADAELDKLTISHLGHLAQRRLSRGIRLNNAEAALICDGHYAVADLMALGRSVLGGRHVLPSVWFTLRQLQVEGTFPTGTYLV… |
| A0A291JP60 | 1-89 | MLVIASDLARRRQQRGLKLNYPEAAAIISFELLEGARDGKSVAELMSYGKQILSEDDVMEGVADMLTDLEIEATFPDGTKLITVHHP… |
| A0A438I2G6 | 3-101 | None |
| A0A533XXU6 | 3-96 | None |
| A0A1Y2CXY4 | 3-101 | None |
| A0A4Z1CHT5 | 1-103 | None |
| B8P4D1 | 1-106 | None |
| A0A6P4ZTS8 | 3-101 | None |
| A0A5J6JMM7 | 1-101 | None |
| A0A2T7PPG9 | 309-399 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.