DPCstruct | MC7896
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 159 ± 22 aa |
| Standard deviation of domain lengths | 21.84 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 24.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09831 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W4KUM9 | 286-462 | SLREKLLQAGLIDEEQAKRAEAEAAAERRRAAQKRRESSPRSGRPKEEARKAQPLTEEERRAREEELAFRQRQRELEREREENRRRA… |
| A0A1J5D1H4 | 6-138 | DALQLSGLVNDKKRRKLEHEQRNKQKKQATEAPNLGAVEPEEAPVLAYLLRVKRIIEEGRLDDAEGRKRFHFVAQDGRIPFLNVNDV… |
| G4E673 | 41-157 | None |
| A0A2D5ZSF8 | 3-167 | None |
| H8L6P8 | 17-179 | None |
| A0A085WIZ6 | 7-127 | None |
| E3PQK2 | 1-169 | None |
| A0A516V2S9 | 14-181 | None |
| A0A534NST5 | 102-283 | None |
| A0A2G6JMH8 | 70-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.