DPCstruct | MC7895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 251 ± 43 aa |
| Standard deviation of domain lengths | 42.61 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0513 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C9SFI5 | 30-256 | RWDLLAVSVVYTSVMSLFTASSALFFFANFVGIFWHVGIASDPPGHSSIAGLVSNILGKFLPAMFCAYVMYDKMGGRRLLRGLTAQV… |
| A0A5J4Y3P2 | 91-359 | TEPTSTVKPSRYYFGGSRYVEKYLFAGVWACLLMCGYASARISAHLRIPPDASTNGQDPFDTFQDISQMLQFGFLLGWFVGVFEAQR… |
| A0A6A5Y2J0 | 200-509 | None |
| A0A7J6KVS2 | 89-352 | None |
| A0A6G1I4L5 | 249-514 | None |
| A0A6A5SXI7 | 227-501 | None |
| Q5AU59 | 313-521 | None |
| A0A662WZ42 | 3-217 | None |
| A0A1J7IFW4 | 489-766 | None |
| A0A1E3NGP4 | 270-609 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.